kashedoutj kashedoutj

07-10-2020
Mathematics

contestada

A rectangle is 11 inches long and 8 inches wide. Find its area.
A
88 square inches
B
96 square inches
с
81 square inches
D
19 square inches

Respuesta :

07-10-2020

Answer:

the answer is A:88 square inches

Answer Link

dreamgurl534 dreamgurl534

07-10-2020

A is the correct answer

Answer Link

Otras preguntas

The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein

how do solar cells help a rescue team

AJUHUDP:3.Seven fair coins are tossed simultaneously. Find the probability of getting (a) no head (b) one her(c) exactly two heads (d) less than two heads (e) m

explain the characteristics strengths, weaknesses of quantitative

16 + 7h = 2 what does that equal too?

What words does Odysseus use to describe the race of cyclops

why are loyalists and patriots important to learn ?? I need details !

Which of the following are remote interior angles of 6? Check all that apply.

Tension force ........... throughout a string that changes direction over a pulley. (Fill in the blank)

What is the missing justification in the proof of the angle bisector construction? B Statement Justification BM is congruent to BN. The segments were drawn by t